PDB entry 5yho

View 5yho on RCSB PDB site
Description: Crystal structure of acetolactate decarboxylase from Enterobacter cloacae
Class: metal binding protein
Keywords: acetolactate decarboxylase Enterobacter cloacae, METAL BINDING PROTEIN
Deposited on 2017-09-29, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-acetolactate decarboxylase
    Species: Klebsiella aerogenes [TaxId:548]
    Gene: budA, aldC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05361 (0-237)
      • engineered mutation (1)
      • engineered mutation (24)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d5yhoa_
  • Chain 'B':
    Compound: alpha-acetolactate decarboxylase
    Species: Klebsiella aerogenes [TaxId:548]
    Gene: budA, aldC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05361
      • engineered mutation (1)
      • engineered mutation (24)
      • engineered mutation (91)
    Domains in SCOPe 2.07: d5yhob_
  • Heterogens: CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yhoA (A:)
    aqhpdsviyqtslmsallsgvyegettiadllahgdfglgtfneldgemiafssqvyqlr
    adgsaraakpeqktpfavmtwfqpqyrktfdtpvsrqqihdvidqqipsdnlfcalridg
    nfrhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehf
    itddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yhoB (B:)
    aqhpdsviyqtslmsallsgvyegettiadllahgdfglgtfneldgemiafssqvyqlr
    adgsaraakpeqktpfavmtwfqpqyrktfdtpvsrqqihdvidqqipsdnlfcalridg
    nfrhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehf
    itddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsven
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yhoB (B:)
    qhpdsviyqtslmsallsgvyegettiadllahgdfglgtfneldgemiafssqvyqlra
    dgsaraakpeqktpfavmtwfqpqyrktfdtpvsrqqihdvidqqipsdnlfcalridgn
    frhahtrtvprqtppyramtdvlddqpvfrfnqregvlvgfrtpqhmqginvagyhehfi
    tddrqggghlldyqlesgvltfgeihklmidlpadsaflqanlhpsnldaairsv