PDB entry 5yh7

View 5yh7 on RCSB PDB site
Description: Crystal structure of the complex of Phosphopantetheine adenylyltransferase from Acinetobacter baumannii with Coenzyme A at 2.0 A resolution
Class: transferase
Keywords: transferase
Deposited on 2017-09-27, released 2017-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Acinetobacter baumannii (strain ACICU) [TaxId:405416]
    Gene: coaD, ACICU_00798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yh7a_
  • Heterogens: COA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yh7A (A:)
    msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
    ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
    pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw