PDB entry 5yh4

View 5yh4 on RCSB PDB site
Description: Miraculin-like protein from Vitis vinifera
Class: hydrolase inhibitor
Keywords: protease inhibitor, beta-trefoil fold, Kunitz superfamily, miraculin, HYDROLASE INHIBITOR
Deposited on 2017-09-27, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mirauclin-like protein
    Species: Vitis vinifera [TaxId:29760]
    Gene: VITISV_025776
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5BCQ0 (0-178)
      • engineered mutation (2)
    Domains in SCOPe 2.07: d5yh4a_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yh4A (A:)
    esapdpvldtegkqlrsgvdyyilpvirgrgggltlastgnencpldvvqeqhevsnglp
    ltftpvnpkkgvirvstdhnikfsasticvqstlwkleydessgqrfvttggvegnpgre
    tldnwfkiekyeddyklvfcptvcdfckpvcgdigiyiqngyrrlalsdvpfkvmfkka