PDB entry 5ygg

View 5ygg on RCSB PDB site
Description: Crystal structure of Fructokinase Double-Mutant (T261C-H108C) from Vibrio cholerae O395 in fructose, ADP and potassium ion bound form
Class: transferase
Keywords: Kinase, Sugar Binding, Double Mutant, TRANSFERASE
Deposited on 2017-09-22, released 2018-09-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructokinase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) [TaxId:345073]
    Gene: cscK, VC0395_0600
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3AER7 (Start-322)
      • engineered mutation (107)
      • engineered mutation (260)
    Domains in SCOPe 2.07: d5ygga_
  • Heterogens: ADP, FRU, CA, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yggA (A:)
    mkalvrlssnhifrsdsmsrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgr
    saffgrvgndpfgrfmqqtltdeqvdcqhlhfdpvhrtstvvvdldecgersftfmvkps
    adqflqlsdipsfqkgewlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevw
    sepqelqatvmravgladvvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakga
    lvatpnsqqivsgkavkpidctgagdafvggllyrlsvaqdwhnqatildavkwangcga
    lattqkgamtalpnqaalyafle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yggA (A:)
    rsdsmsrvwltgdavvdlipdgqqhylkcpggapanvavaiarlsgrsaffgrvgndpfg
    rfmqqtltdeqvdcqhlhfdpvhrtstvvvdldecgersftfmvkpsadqflqlsdipsf
    qkgewlhvcsialanqpsrsstfaaiaqmkevggyvsfdpnlreevwsepqelqatvmra
    vgladvvkfseeelqfltgtqsieeglqaiadfqiplvvvtlgakgalvatpnsqqivsg
    kavkpidctgagdafvggllyrlsvaqdwhnqatildavkwangcgalattqkgamtalp
    nqaalyafle