PDB entry 5yfi

View 5yfi on RCSB PDB site
Description: Crystal structure of the clinically important GPCR in complex with functional antibody
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2017-09-21, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YFI
  • Chain 'L':
    Compound: light chain of Fab fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YFI (Start-235)
    Domains in SCOPe 2.07: d5yfil1, d5yfil2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5yfiL (L:)
    mdmrtpaqflgilllwfpgikcdikmtqspssmyvslgervtitckasqdinrylswfqq
    kpgkspktliyranrmldgvpsrfsgsgsgqdysltissleyedmgnyyclqydefpftf
    gsgtkleikradaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqng
    vlnswtdqdskdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yfiL (L:)
    dikmtqspssmyvslgervtitckasqdinrylswfqqkpgkspktliyranrmldgvps
    rfsgsgsgqdysltissleyedmgnyyclqydefpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec