PDB entry 5yec

View 5yec on RCSB PDB site
Description: Crystal structure of Atg7CTD-Atg8-MgATP complex in form II
Class: protein transport/metal binding protein
Keywords: Autophagy, E1 enzyme, Ubiquitin-like protein, METAL BINDING PROTEIN, PROTEIN TRANSPORT-METAL BINDING PROTEIN complex
Deposited on 2017-09-16, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like modifier-activating enzyme ATG7
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ATG7, APG7, CVT2, YHR171W
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38182
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5yecb_
  • Chain 'C':
    Compound: Ubiquitin-like modifier-activating enzyme ATG7
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ATG7, APG7, CVT2, YHR171W
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Autophagy-related protein 8
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ATG8, APG8, AUT7, CVT5, YBL078C, YBL0732
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38182
      • engineered mutation (28)
    Domains in SCOPe 2.07: d5yecd_
  • Heterogens: ZN, ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yecB (B:)
    gphmkstfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yecB (B:)
    tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
    irkrimlppaififvndtlpptaalmsaiyqehkdkdgflyvtysg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5yecD (D:)
    gphmkstfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltv
    gqfvyvirkrimlppekaififvndtlpptaalmsaiyqehkdkdgflyvtysgentfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yecD (D:)
    tfkseypfekrkaeseriadrfpnripvicekaeksdipeidkrkylvpadltvgqfvyv
    irkrimfifvndtlpptaalmsaiyqehkdkdgflyvty