PDB entry 5ycz

View 5ycz on RCSB PDB site
Description: Crystal structure of Alocasin, protease inhibitor from Giant Taro (Arum macrorrhizon)
Class: plant protein
Keywords: Protease inhibitor, Storage protein, Tubers, Alocasia, Alocasin, Kunitz type, PLANT PROTEIN
Deposited on 2017-09-08, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin/chymotrypsin inhibitor
    Species: Alocasia macrorrhizos [TaxId:4456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ycza_
  • Chain 'B':
    Compound: Trypsin/chymotrypsin inhibitor
    Species: Alocasia macrorrhizos [TaxId:4456]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5yczb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5yczA (A:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
    enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
    agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
    vkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yczA (A:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
    enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
    agsqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5yczB (B:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfdeysgrplaffp
    enadddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairk
    agdassqprdyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvk
    vkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5yczB (B:)
    tnpvldvdgnelqrgqlyyatsvmrpgggltlaapkgscplnvaqapfsgrplaffpena
    dddtvqegstlyimfpeptrcpqstvwtfdreagfvttggttskaigphnsrfairkagd
    dyqievcpcstgverpscrmgclgtlglaeggknvllninnesphtirfvkv