PDB entry 5ych

View 5ych on RCSB PDB site
Description: Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)
Class: oxygen storage
Keywords: Globin, Molecular Archaeology, Ancient protein, Protein evolution, Deep-sea adaptation, OXYGEN STORAGE
Deposited on 2017-09-07, released 2018-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCH (0-End)
    Domains in SCOPe 2.08: d5ycha_
  • Heterogens: HEM, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5ychA (A:)
mvlsdgewqlvlniwakveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkase
dlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgfqg

    Sequence, based on observed residues (ATOM records): (download) 
    >5ychA (A:)
mvlsdgewqlvlniwakveadvaghgqdvlirlfkghpetlekfdkfkhlkteaemkase
dlkkhgntvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhsrh
pgdfgadaqgamnkalelfrkdiaakykelgfq