PDB entry 5ycb

View 5ycb on RCSB PDB site
Description: Crystal structure of notothenia coriiceps adenylate kinase variant
Class: transferase
Keywords: phosphorylation, TRANSFERASE
Deposited on 2017-09-07, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: Notothenia coriiceps [TaxId:8208]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCB (Start-192)
    Domains in SCOPe 2.07: d5ycba_
  • Chain 'B':
    Compound: adenylate kinase
    Species: Notothenia coriiceps [TaxId:8208]
    Database cross-references and differences (RAF-indexed):
    • PDB 5YCB (Start-192)
    Domains in SCOPe 2.07: d5ycbb_
  • Heterogens: AP5, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ycbA (A:)
    madkikdakiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyida
    kgetmvkrlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvd
    evfkqvstaidal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycbA (A:)
    ikdakiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqaimqkg
    elvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyidakget
    mvkrlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvdevfk
    qvstaidal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ycbB (B:)
    madkikdakiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqai
    mqkgelvpldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyida
    kgetmvkrlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvd
    evfkqvstaidal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ycbB (B:)
    akiifvvggpgsgkgtqcekvvakygythlssgdllraevssgsergkqlqaimqkgelv
    pldtvldmikdamiakadvskgylidgyprevkqgeefekkigkpclllyidakgetmvk
    rlmkrgetsgraddneetikkrldlyykatepviafyegrgivrkidselpvdevfkqvs
    taidal