PDB entry 5yc6

View 5yc6 on RCSB PDB site
Description: The crystal structure of uPA in complex with 4-Bromobenzylamirne at pH4.6
Class: hydrolase/hydrolase inhibitor
Keywords: halogen bonding, serine protease, uPA, P1 group, protease inhibitors, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-09-06, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-245)
      • conflict (120)
      • conflict (143)
    Domains in SCOPe 2.07: d5yc6u_
  • Heterogens: PZH, SO4, PGE, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yc6U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtk