PDB entry 5ybz

View 5ybz on RCSB PDB site
Description: High resolution structure of complement C1q-like protein 3 C1q domain
Class: signaling protein
Keywords: signaling protein
Deposited on 2017-09-05, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESN4 (4-134)
      • expression tag (0-3)
      • expression tag (135)
    Domains in SCOPe 2.07: d5ybza1, d5ybza2, d5ybza3
  • Chain 'C':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESN4 (4-134)
      • expression tag (3)
      • expression tag (135)
    Domains in SCOPe 2.07: d5ybzc1, d5ybzc2, d5ybzc3
  • Chain 'D':
    Compound: Complement C1q-like protein 3
    Species: Mus musculus [TaxId:10090]
    Gene: C1ql3, C1ql, Ctrp13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ESN4 (4-134)
      • expression tag (0-3)
      • expression tag (135)
    Domains in SCOPe 2.07: d5ybzd1, d5ybzd2, d5ybzd3
  • Heterogens: DMS, SO4, CL, NA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ybzA (A:)
    apgdpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmr
    ggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggn
    nnkystfsgfiiyadaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ybzA (A:)
    apgdpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmr
    ggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggn
    nnkystfsgfiiyada
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ybzC (C:)
    apgdpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmr
    ggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggn
    nnkystfsgfiiyadaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ybzC (C:)
    dpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmrggd
    gtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggnnnk
    ystfsgfiiyada
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ybzD (D:)
    apgdpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmr
    ggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggn
    nnkystfsgfiiyadaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ybzD (D:)
    apgdpkiafyaglkrqhegyevlkfddvvtnlgnhydpttgkftcsipgiyfftyhvlmr
    ggdgtsmwadlcknnqvrasaiaqdadqnydyasnsvvlhlepgdevyikldggkahggn
    nnkystfsgfiiyada