PDB entry 5yam

View 5yam on RCSB PDB site
Description: Solution structure of mice Met-CCL5/RANTES
Class: cytokine
Keywords: inflammatory, heparin, dimer, antagonist, chemokine, CYTOKINE
Deposited on 2017-09-01, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 5
    Species: Mus musculus [TaxId:10090]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30882 (1-68)
      • expression tag (0)
    Domains in SCOPe 2.07: d5yama1, d5yama2
  • Chain 'B':
    Compound: c-c motif chemokine 5
    Species: Mus musculus [TaxId:10090]
    Gene: CCL5, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30882 (1-68)
      • expression tag (0)
    Domains in SCOPe 2.07: d5yamb1, d5yamb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yamA (A:)
    mspygsdttpccfaylslalprahvkeyfytsskcsnlavvfvtrrnrqvcanpekkwvq
    eyinylems
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5yamB (B:)
    mspygsdttpccfaylslalprahvkeyfytsskcsnlavvfvtrrnrqvcanpekkwvq
    eyinylems