PDB entry 5y9z

View 5y9z on RCSB PDB site
Description: Crystal structure of rat hematopoietic prostaglandin D synthase
Class: transferase
Keywords: prostaglandin D synthase, TRANSFERASE
Deposited on 2017-08-29, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y9za1, d5y9za2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HPGDS, GSTS, PGDS, PTGDS2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y9zb1, d5y9zb2
  • Heterogens: GSH, MG, DIO, EDO, GOL, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y9zA (A:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y9zA (A:)
    pnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvlevegltl
    hqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndllt
    rqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkv
    qaipaisawilkrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y9zB (B:)
    mpnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvleveglt
    lhqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndll
    trqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnk
    vqaipaisawilkrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y9zB (B:)
    pnykllyfnmrgraeiiryifayldikyedhrieqadwpkikptlpfgkipvlevegltl
    hqslaiaryltkntdlagkteleqcqvdavvdtlddfmslfpwaeenqdlkertfndllt
    rqaphllkdldtylgdkewfignyvtwadfywdicsttllvlkpdllgiyprlvslrnkv
    qaipaisawilkrpqtkl