PDB entry 5y9l

View 5y9l on RCSB PDB site
Description: Human kallikrein 7 in complex with 1,3,6-trisubstituted 1,4-diazepane-7-one
Class: hydrolase
Keywords: protease, inhibitor complex, HYDROLASE
Deposited on 2017-08-25, released 2017-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5y9la_
  • Heterogens: 8R3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y9lA (A:)
    iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
    aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
    gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
    vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkkhr