PDB entry 5y98

View 5y98 on RCSB PDB site
Description: Crystal structure of native unbound peptidyl tRNA hydrolase from Acinetobacter baumannii at 1.36 A resolution
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-08-23, released 2017-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / CIP 70.34 / JCM 6841 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) [TaxId:575584]
    Gene: pth, F911_03144, HMPREF0010_01329
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0C9L6 (3-195)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d5y98a1, d5y98a2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5y98A (A:)
    gshmsnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieg
    hdvrlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghng
    lrdivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvq
    gqvpqamnqinaykpa