PDB entry 5y91

View 5y91 on RCSB PDB site
Description: The structure of the MHC class I molecule of bony fishes provides insights into the conserved nature of the antigen-presenting system
Class: immune system
Keywords: Fish, MHC class I, Evolution, IMMUNE SYSTEM
Deposited on 2017-08-22, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen
    Species: Ctenopharyngodon idella [TaxId:7959]
    Gene: UAA106
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Ctenopharyngodon idella [TaxId:7959]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y91b_
  • Chain 'C':
    Compound: peptide phe-ala-asn-phe-cys-leu-met-met-ile
    Species: Spring viraemia of carp virus [TaxId:696863]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5Y91 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5y91B (B:)
mralvsfalfcvlyisvqgkvsspkiqvyshypgeygkentlicyvsgfhppdisiellk
ngeviadaqqtdlafekgwqfhltksvsfkpeksdeyscsvrhmsktkkivwesnm

    Sequence, based on observed residues (ATOM records): (download) 
    >5y91B (B:)
kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw
qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm

  • Chain 'C':
    No sequence available.