PDB entry 5y8t

View 5y8t on RCSB PDB site
Description: Crystal structure of Bacillus subtilis PadR in complex with p-coumaric acid
Class: transcription
Keywords: Transcription factor, TRANSCRIPTION
Deposited on 2017-08-21, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: padR, BSUW23_04210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y8ta_
  • Chain 'B':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: padR, BSUW23_04210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y8tb_
  • Chain 'C':
    Compound: Transcriptional regulator
    Species: Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) [TaxId:655816]
    Gene: padR, BSUW23_04210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y8tc_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y8tA (A:)
    gsakdpmrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfi
    tfrttiqgtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeas
    dlftdqllkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswles
    ilamided
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8tA (A:)
    rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitytltds
    gkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkaklsdlqgsy
    eklmapmsfsspdfghylvltkalereknyvswlesilamid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y8tB (B:)
    gsakdpmrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfi
    tfrttiqgtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeas
    dlftdqllkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswles
    ilamided
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8tB (B:)
    rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrtkkm
    ytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkakls
    dlqgsyeklmapmsfsspdfghylvltkalereknyvswlesilamide
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y8tC (C:)
    gsakdpmrvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfi
    tfrttiqgtklekkmytltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeas
    dlftdqllkrkaklsdlqgsyeklmasaepmsfsspdfghylvltkalereknyvswles
    ilamided
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y8tC (C:)
    rvlkyailgllrkgelsgyditsyfkeelgqfwsakhsqiypelkkltdegfitfrkmyt
    ltdsgkqelhdwlirhqpipetvkdefmlkayfisslsrqeasdlftdqllkrkaklsdl
    qgsyeklmapmsfsspdfghylvltkalereknyvswlesilamid