PDB entry 5y7n

View 5y7n on RCSB PDB site
Description: Crystal structure of AKR1B10 in complex with NADP+ and Androst-4-ene-3-beta-6-alpha-diol
Class: oxidoreductase
Keywords: AKR1B10, steroid, complex, inhibitor, ANTITUMOR PROTEIN, OXIDOREDUCTASE
Deposited on 2017-08-17, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member B10
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B10, AKR1B11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y7na_
  • Heterogens: NAP, 8QL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y7nA (A:)
    matfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiq
    ekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgd
    dlfpkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykp
    vtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaak
    hkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracn
    vlqsshledypfnaey
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y7nA (A:)
    fvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgeaiqeki
    qekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfksgddlf
    pkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglkykpvtn
    qvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeiaakhkk
    taaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwracnvlq
    sshledypfnaey