PDB entry 5y64

View 5y64 on RCSB PDB site
Description: Phosphoglycerate mutase 1 H11 phosphorylated form complexed with KH1
Class: isomerase/inhibitor
Keywords: ISOMERASE, ISOMERASE-INHIBITOR complex
Deposited on 2017-08-10, released 2018-12-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-05, with a file datestamp of 2018-11-30.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y64b_
  • Chain 'C':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y64c_
  • Heterogens: 8LF, CL, MES, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y64B (B:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y64B (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y64C (C:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y64C (C:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd