PDB entry 5y3q

View 5y3q on RCSB PDB site
Description: Crystal structure of SARS coronavirus papain-like protease conjugated with beta-mercaptoethanol
Class: hydrolase
Keywords: complex structure, HYDROLASE
Deposited on 2017-07-29, released 2018-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Replicase polyprotein 1a
    Species: Human SARS coronavirus [TaxId:227859]
    Gene: 1a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C6U8 (1-314)
      • initiating methionine (0)
      • expression tag (315-316)
    Domains in SCOPe 2.07: d5y3qa1, d5y3qa2, d5y3qa3
  • Heterogens: ZN, BME, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y3qA (A:)
    mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp
    sddtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvlla
    lqqlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanle
    sakrvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqes
    sfvmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgp
    vtdvfyketsytttilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3qA (A:)
    mevktikvfttvdntnlhtqlvdmsmtygqqfgptyldgadvtkikphvnhegktffvlp
    sddtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvlla
    lqqlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanle
    sakrvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqes
    sfvmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgp
    vtdvfyketsytttile