PDB entry 5y3b

View 5y3b on RCSB PDB site
Description: Crystal structure of mouse Ccd1 DIX domain
Class: signaling protein
Keywords: Wnt signal, SIGNALING PROTEIN
Deposited on 2017-07-28, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y3ba_
  • Chain 'B':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y3bb_
  • Chain 'C':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80Y83 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.06: d5y3bc1, d5y3bc2
  • Chain 'D':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y3bd_
  • Chain 'E':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y3be_
  • Chain 'F':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q80Y83 (3-85)
      • expression tag (2)
    Domains in SCOPe 2.06: d5y3bf1, d5y3bf2
  • Chain 'G':
    Compound: Dixin
    Species: Mus musculus [TaxId:10090]
    Gene: Dixdc1, Ccd1, Kiaa1735
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5y3bg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5y3bA (A:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bA (A:)
    stctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkee
    vfhdddaipgwegkivawveed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y3bB (B:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bB (B:)
    tctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkeev
    fhdddaipgwegkivawveed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y3bC (C:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bC (C:)
    gsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvk
    eevfhdddaipgwegkivawvee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5y3bD (D:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bD (D:)
    tctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkeev
    fhdddaipgwegkivawveed
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5y3bE (E:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bE (E:)
    stctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkee
    vfhdddaipgwegkivawveed
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5y3bF (F:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bF (F:)
    gsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvk
    eevfhdddaipgwegkivawveed
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5y3bG (G:)
    gpgsstctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgt
    vkeevfhdddaipgwegkivawveed
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y3bG (G:)
    stctkvlyftdrsltpfmvnipkrlgevtlkdfkaaidregnhryhfkaldpefgtvkee
    vfhdddaipgwegkivawveed