PDB entry 5y2u

View 5y2u on RCSB PDB site
Description: X-ray structure of Phosphoglycerate Mutase 1(PGAM1) complexed with a small molecule
Class: isomerase/inhibitor
Keywords: Phosphoglycerate Mutase 1, ISOMERASE-INHIBITOR complex
Deposited on 2017-07-27, released 2018-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-08, with a file datestamp of 2018-08-03.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2ub_
  • Chain 'C':
    Compound: phosphoglycerate mutase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PGAM1, PGAMA, CDABP0006
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5y2uc_
  • Heterogens: CL, AZN, MES, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5y2uB (B:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2uB (B:)
    ayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqkr
    airtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydvp
    pppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrvl
    iaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5y2uC (C:)
    maayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvq
    krairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsyd
    vppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkr
    vliaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgdeetvr
    kameavaaqgkakklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5y2uC (C:)
    aayklvlirhgesawnlenrfsgwydadlspagheeakrggqalrdagyefdicftsvqk
    rairtlwtvldaidqmwlpvvrtwrlnerhyggltglnkaetaakhgeaqvkiwrrsydv
    ppppmepdhpfysniskdrryadltedqlpsceslkdtiaralpfwneeivpqikegkrv
    liaahgnslrgivkhleglseeaimelnlptgipivyeldknlkpikpmqflgd