PDB entry 5y23

View 5y23 on RCSB PDB site
Description: X-ray crystal structure of Pseudoazurin Met16Phe variant
Class: electron transport
Keywords: Electron transfer, Cupredoxin, ELECTRON TRANSPORT
Deposited on 2017-07-23, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.08: d5y23a_
  • Chain 'B':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
    Domains in SCOPe 2.08: d5y23b_
  • Heterogens: CU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5y23A (A:)
adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5y23B (B:)
adfevhmlnkgkdgafvfepaslkvapgdtvtfiptdkghnvetikgmipdgaeafkski
nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
algn