PDB entry 5xzx

View 5xzx on RCSB PDB site
Description: Crystal structure of importin-alpha3 bound to the nuclear localization signal of Ran-binding protein 3
Class: transport protein
Keywords: nuclear import, TRANSPORT PROTEIN
Deposited on 2017-07-14, released 2017-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-3
    Species: Homo sapiens [TaxId:9606]
    Gene: KPNA4, QIP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xzxa_
  • Chain 'B':
    Compound: ran-binding protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RANBP3
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xzxA (A:)
    ntsleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnp
    slqfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgp
    qcrdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcv
    lihhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravg
    nivtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanl
    vpmiihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvq
    vvldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xzxA (A:)
    sleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnpsl
    qfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpqc
    rdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvli
    hhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgni
    vtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlvp
    miihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqvv
    ldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqff
    

  • Chain 'B':
    No sequence available.