PDB entry 5xz0

View 5xz0 on RCSB PDB site
Description: Staphylococcal Enterotoxin B (SEB) mutant S19 - N23A, Y90A, R110A and F177A
Class: toxin
Keywords: Staphylococcal aureus, Enterotoxin, SEB, TOXIN
Deposited on 2017-07-11, released 2017-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal enterotoxin b
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: seb, SACOL0907
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H2WZB2 (0-234)
      • engineered mutation (21)
      • engineered mutation (88)
      • engineered mutation (108)
      • engineered mutation (175)
    Domains in SCOPe 2.08: d5xz0a1, d5xz0a2
  • Chain 'B':
    Compound: staphylococcal enterotoxin b
    Species: Staphylococcus aureus (strain COL) [TaxId:93062]
    Gene: seb, SACOL0907
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H2WZB2 (0-234)
      • engineered mutation (21)
      • engineered mutation (88)
      • engineered mutation (108)
      • engineered mutation (175)
    Domains in SCOPe 2.08: d5xz0b1, d5xz0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xz0A (A:)
    sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyayqcyfskktndinshqtdkaktcmyggvteh
    ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannsp
    yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz0A (A:)
    sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyayqcydkaktcmyggvtehngnqldkyrsitv
    rvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannspyetgyikfienen
    sfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xz0B (B:)
    sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyayqcyfskktndinshqtdkaktcmyggvteh
    ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannsp
    yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xz0B (B:)
    sqpdpkpdelhksskftglmeamkvlyddnhvsainvksidqflyfdliysikdtklgny
    dnvrvefknkdladkykdkyvdvfganyayqcydkaktcmyggvtehngnqldkyrsitv
    rvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyeannspyetgyikfienen
    sfwydmmpapgdkfdqskylmmyndnkmvdskdvkievyltt