PDB entry 5xxi

View 5xxi on RCSB PDB site
Description: Crystal structure of CYP2C9 in complex with multiple losartan molecules
Class: oxidoreductase
Keywords: oxidoreductase, CYP2C9, P450 2C9
Deposited on 2017-07-04, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 2C9
    Species: Homo sapiens [TaxId:9606]
    Gene: CYP2C9, CYP2C10
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11712 (0-462)
      • engineered mutation (462)
    Domains in SCOPe 2.07: d5xxia_
  • Heterogens: LSN, HEM, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xxiA (A:)
    klppgptplpvignilqigikdisksltnlskvygpvftlyfglkpivvlhgyeavkeal
    idlgeefsgrgifplaeranrgfgivfsngkkwkeirrfslmtlrnfgmgkrsiedrvqe
    earclveelrktkaspcdptfilgcapcnvicsiifhkrfdykdqqflnlmeklneniki
    lsspwiqicnnfspiidyfpgthnkllknvafmksyilekvkehqesmdmnnpqdfidcf
    lmkmekekhnqpseftieslentavdlfgagtettsttlryalllllkhpevtakvqeei
    ervigrnrspcmqdrshmpytdavvhevqryidllptslphavtcdikfrnylipkgtti
    lisltsvlhdnkefpnpemfdphhfldeggnfkkskyfmpfsagkricvgealagmelfl
    fltsilqnfnlkslvdpknldttpvvngfasvppfyqlcfipi