PDB entry 5xx6

View 5xx6 on RCSB PDB site
Description: Hetero-micro-seeding: Crystal structure of BPTI-[5,55]C14GA38I variant using micro-seeds from -C14GA38G variant
Class: hydrolase
Keywords: hydrolase inhibitor, hydrolase
Deposited on 2017-07-01, released 2018-07-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.31 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered mutation (13)
      • engineered mutation (29)
      • engineered mutation (37)
      • engineered mutation (50-51)
    Domains in SCOPe 2.08: d5xx6a_
  • Chain 'B':
    Compound: pancreatic trypsin inhibitor
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00974 (0-57)
      • engineered mutation (13)
      • engineered mutation (29)
      • engineered mutation (37)
      • engineered mutation (50-51)
    Domains in SCOPe 2.08: d5xx6b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xx6A (A:)
    rpdfcleppytgpgkariiryfynakaglaqtfvyggirakrnnfksaedalrtcgga
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xx6B (B:)
    rpdfcleppytgpgkariiryfynakaglaqtfvyggirakrnnfksaedalrtcgga