PDB entry 5xtl

View 5xtl on RCSB PDB site
Description: Crystal Structure of Transketolase in complex with aminopyrimidine and cysteine sulfonic acid adduct from Pichia Stipitis
Class: transferase
Keywords: transketolase, TRANSFERASE
Deposited on 2017-06-20, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transketolase
    Species: Scheffersomyces stipitis CBS 6054 [TaxId:322104]
    Gene: TKT, TKT1, PICST_67105
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xtla1, d5xtla2, d5xtla3
  • Heterogens: P23, CA, PEG, 8GF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xtlA (A:)
    mgsshhhhhhssglvprgshmssvdqkaistirllavdavaaansghpgaplglapaaha
    vfkkmrfnpkdtkwinrdrfvlsnghacallysmlvlygydltvedlkkfrqlgsktpgh
    pentdvpgaevttgplgqgicngvgialaqaqfaatynkpdfpisdsytyvflgdgclme
    gvsseasslaghlqlgnliafwddnkisidgstevaftedviaryksygwhivevsdadt
    ditaiaaaideakkvtnkptlvrltttigfgslaqgthgvhgaplkaddikqlktkwgfn
    peesfavpaevtasynehvaenqkiqqqwnelfaaykqkypelgaelqrrldgklpenwd
    kalpvytpadaavatrklseivlskiipevpeiiggsadltpsnltkakgtvdfqpaatg
    lgdysgryirygvrehamgaimngiaafganyknyggtflnfvsyaagavrlsalsefpi
    twvathdsiglgedgpthqpietlahfratpnisvwrpadgnetsaayksaiesthtphi
    laltrqnlpqlegssiekaskggytlvqqdkadiiivatgsevslavdalkvlegqgika
    gvvslpdqltfdkqseeyklsvlpdgvpilsvevmstfgwskyshqqfglnrfgasgkap
    eifklfeftpegvaeraaktvafykgkdvvsplrsaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xtlA (A:)
    svdqkaistirllavdavaaansghpgaplglapaahavfkkmrfnpkdtkwinrdrfvl
    snghacallysmlvlygydltvedlkkfrqlgsktpghpentdvpgaevttgplgqgicn
    gvgialaqaqfaatynkpdfpisdsytyvflgdgclmegvsseasslaghlqlgnliafw
    ddnkisidgstevaftedviaryksygwhivevsdadtditaiaaaideakkvtnkptlv
    rltttigfgslaqgthgvhgaplkaddikqlktkwgfnpeesfavpaevtasynehvaen
    qkiqqqwnelfaaykqkypelgaelqrrldgklpenwdkalpvytpadaavatrklseiv
    lskiipevpeiiggsadltpsnltkakgtvdfqpaatglgdysgryirygvrehamgaim
    ngiaafganyknyggtflnfvsyaagavrlsalsefpitwvathdsiglgedgpthqpie
    tlahfratpnisvwrpadgnetsaayksaiesthtphilaltrqnlpqlegssiekaskg
    gytlvqqdkadiiivatgsevslavdalkvlegqgikagvvslpdqltfdkqseeyklsv
    lpdgvpilsvevmstfgwskyshqqfglnrfgasgkapeifklfeftpegvaeraaktva
    fykgkdvvsplrsaf