PDB entry 5xt8

View 5xt8 on RCSB PDB site
Description: Magnesium bound apo structure of thymidylate kinase (form I) from Thermus thermophilus HB8
Class: transferase
Keywords: Nucleotide monophosphate kinase, TRANSFERASE
Deposited on 2017-06-17, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xt8a_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xt8b_
  • Heterogens: MG, CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xt8A (A:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xt8A (A:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatlp
    eeeiaraiqahlrpllp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xt8B (B:)
    mpglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xt8B (B:)
    pglfltlegldgsgkttqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalrrvlgleffrrvregylalaraepgrfvvldatlpeeeiarai
    qahlrpllp