PDB entry 5xs4

View 5xs4 on RCSB PDB site
Description: Structure of Coxsackievirus A6 (CVA6) virus A-particle
Class: virus
Keywords: Coxsackievirus A6, A-particle, icosahedral, VIRUS
Deposited on 2017-06-12, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: EM
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Coxsackievirus A6 [TaxId:86107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xs4a1
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Coxsackievirus A6 [TaxId:86107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xs4b_
  • Chain 'C':
    Compound: Genome polyprotein
    Species: Coxsackievirus A6 [TaxId:86107]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xs4c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xs4A (A:)
    ndpianavesavsaladttisrvtaanttasthslgtgrvpalqaaetgassnasdenlv
    etrcvmnrngvneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklel
    stymrfdaeftfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsd
    pppqvsvpfmspatayqwfydgyptfgehkqatnlqygqcpnnmmghfairtvsesttgk
    nvhvrvymrikhvrawvprplrsqaymvknyptysqtitntatdrasitttdyeggvpas
    pqrts
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xs4A (A:)
    vneasvehfysraglvgvvevkdsgtsldgytvwpidvmgfvqqrrklelstymrfdaef
    tfvsnlsnsttpgmllqymyvppgapkpdgrksyqwqtatnpsvfaklsdpppqvsvpfm
    spatayqwfydgyptnlqygqcpnnmmghfairtvsesttgknvhvrvymrikhvrawvp
    rplrsqaymvknyptysqtitntatdrasittt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xs4B (B:)
    spsveacgysdrvaqltvgnstittqeaanivlsygewpeycpstdatavdkptrpdvsv
    nrfytlstkswktestgwywkfpdvlndtgvfgqnaqfhylyrsgfcmhvqcnaskfhqg
    allvaaipefviaasspatkpngrglypdfahtnpgkdgqefrdpyvldagiplsqalvf
    phqwinlrtnncatiimpyvnalpfdsalnhsnfglvvipisplkycngattevpvtlti
    aplnsefsglrqaikq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xs4B (B:)
    nivlsygewpeycptrpdvsvnrfytlstkswktestgwywkfpdvlndtgvfgqnaqfh
    ylyrsgfcmhvqcnaskfhqgallvaaipefviaassplypdfahtnpgkdgqefrdpyv
    ldagiplsqalvfphqwinlrtnncatiimpyvnalpfdsalnhsnfglvvipisplkyc
    ngattevpvtltiaplnsefsgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xs4C (C:)
    gfptelkpgtnqflttddgtsppilpgfeptplihipgeftslldlcqietilevnnttg
    tigvsrllipvraqnnvdqlcasfqvdpgrngpwqstmvgqicryytqwsgslkvtfmft
    gsfmatgkmliaytppgsaqpatreaamlgthivwdfglqssvtlvipwisnthfravki
    ggvydyyatgivtiwyqtnfvvppdtpteaniialgaaqknftlklckdtdeiqqtaayq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xs4C (C:)
    ptelkpgtnqflttddgtsppilpgfeptplihipgeftslldlcqietilevnnttigv
    srllipvraqnnvdqlcasfqvdpgrngpwqstmvgqicryytqwsgslkvtfmftgsfm
    atgkmliaytppgsaqpatreaamlgthivwdfglqssvtlvipwisntgivtiwyqtnf
    vvppdtpteaniialgaaqknftlklckdt