PDB entry 5xs3

View 5xs3 on RCSB PDB site
Description: Crystal structure of HLA Class I antigen
Class: immune system
Keywords: HLA Class I antigen, IMMUNE SYSTEM
Deposited on 2017-06-12, released 2017-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XS3 (0-272)
    Domains in SCOPe 2.06: d5xs3a1, d5xs3a2
  • Chain 'B':
    Compound: light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XS3 (0-97)
    Domains in SCOPe 2.06: d5xs3b_
  • Chain 'C':
    Compound: p
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XS3 (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xs3A (A:)
    shsmryfdtavsrpgrgeprfisvgyvddtqfvrfdsdaasprgeprapwveqegpeywd
    retqkykrqaqadrvnlrklrgyynqsedgshtlqwmygcdlgpdgrllrgydqsaydgk
    dyialnedlrswtaadtaaqitqrkweaareaeqwraylegtcvewlrrylengketlqr
    aehpkthvthhpvsdheatlrcwalgfyparitltwqrdgedqtqdtelvetrpagdgtf
    qkwaavvvpsgeeqrytchvqheglpepltlrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xs3A (A:)
    shsmryfdtavsrpgeprfisvgyvddtqfvrfdsdaasprgeprapwveqegpeywdre
    tqkykrqaqadrvnlrklrgyynqsedgshtlqwmygcdlgpdgrllrgydqsaydgkdy
    ialnedlrswtaadtaaqitqrkweaareaeqwraylegtcvewlrrylengketlqrae
    hpkthvthhpvsdheatlrcwalgfyparitltwqrdgedqtqdtelvetrpagdgtfqk
    waavvvpsgeeqrytchvqheglpepltlrw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xs3B (B:)
    mqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfsgdw
    sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
    

  • Chain 'C':
    No sequence available.