PDB entry 5xqz

View 5xqz on RCSB PDB site
Description: Structure of the MOB1-NDR2 complex
Class: signaling protein/transferase
Keywords: signaling protein-transferase complex
Deposited on 2017-06-07, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xqza_
  • Chain 'B':
    Compound: MOB kinase activator 1A
    Species: Homo sapiens [TaxId:9606]
    Gene: MOB1A, C2orf6, MOB4B, MOBK1B, MOBKL1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H8S9 (9-192)
      • expression tag (0-8)
    Domains in SCOPe 2.07: d5xqzb1, d5xqzb2
  • Chain 'C':
    Compound: Serine/threonine-protein kinase 38-like
    Species: Homo sapiens [TaxId:9606]
    Gene: STK38L, KIAA0965, NDR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H1 (5-End)
      • expression tag (1-4)
  • Chain 'D':
    Compound: Serine/threonine-protein kinase 38-like
    Species: Homo sapiens [TaxId:9606]
    Gene: STK38L, KIAA0965, NDR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y2H1 (5-67)
      • expression tag (0-4)
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xqzA (A:)
    aahhssghmeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteas
    cpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpkn
    fmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelap
    lqelieklgskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xqzA (A:)
    eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
    yeyhwadnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktilkr
    lfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xqzB (B:)
    aahhssghmeatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteas
    cpvmsagpryeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpkn
    fmsvaktilkrlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelap
    lqelieklgskdr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.