PDB entry 5xqw

View 5xqw on RCSB PDB site
Description: Catalytic antibody 7B9
Class: immune system
Keywords: catalytic antibody, hydrolytic enzyme, Fab, transition-state analogue, IMMUNE SYSTEM
Deposited on 2017-06-07, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab fragment of catalytic antibody 7B9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XQW (0-216)
  • Chain 'L':
    Compound: Fab fragment of catalytic antibody 7B9, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5XQW (0-210)
    Domains in SCOPe 2.07: d5xqwl1, d5xqwl2
  • Heterogens: 8EU, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xqwL (L:)
    dilmtqqpssmsvslgdtvtitchasqgirsnigwlqqkpgksfkgliylgtnledevps
    rfsgsgsgadysltisslesedfadyycvqyaqfprtfgggtrleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr