PDB entry 5xqm

View 5xqm on RCSB PDB site
Description: NMR solution structure of SMO1, Sumo homologue in Caenorhabditis elegans
Class: signaling protein
Keywords: solution structure, Caenorhabditis elegans, Sumo homologue, SIGNALING PROTEIN
Deposited on 2017-06-07, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small ubiquitin-related modifier
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: smo-1, smt3, sumo, K12C11.2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xqma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5xqmA (A:)
mhhhhhhmaddaaqagdnaeyikikvvgqdsnevhfrvkygtsmaklkksyadrtgvavn
slrflfdgrrindddtpktlemedddvievyqeqlgg

    Sequence, based on observed residues (ATOM records): (download) 
    >5xqmA (A:)
maddaaqagdnaeyikikvvgqdsnevhfrvkygtsmaklkksyadrtgvavnslrflfd
grrindddtpktlemedddvievyqeqlgg