PDB entry 5xn5

View 5xn5 on RCSB PDB site
Description: Homo-dimer crystal structure of geranylgeranyl diphosphate synthases 1 from Oryza sativa
Class: transferase
Keywords: homo-dimer, lsu-lsu, transferase, OSGGPPS1
Deposited on 2017-05-18, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Os07g0580900 protein
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Os07g0580900, OJ1301_C12.3, OSNPB_070580900, P0453G03.27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xn5a_
  • Chain 'B':
    Compound: Os07g0580900 protein
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Os07g0580900, OJ1301_C12.3, OSNPB_070580900, P0453G03.27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xn5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xn5A (A:)
    tgfdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavv
    ggreawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdalls
    lsfhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtgstetvpl
    erleyihlhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkss
    eelgktagkdlasdkttypkllgleksrefaekllsdareqlsgfdqetaapllhlanyi
    ayrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xn5A (A:)
    gfdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavvg
    greawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdallsl
    sfhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtvplerleyi
    hlhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkdlasdktt
    ypkllgleksrefaekllsdareqlsgfdqetaapllhlanyiayrqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xn5B (B:)
    tgfdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavv
    ggreawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdalls
    lsfhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtgstetvpl
    erleyihlhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkss
    eelgktagkdlasdkttypkllgleksrefaekllsdareqlsgfdqetaapllhlanyi
    ayrqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xn5B (B:)
    fdfnaymgekaaavnraldasipadeppaalheamryallaggkrvrpalclaacavvgg
    reawampaaaavemvhtmslvhddlpcmddddlrrgkptchvvygepiavltgdallsls
    fhhmarfdsyppdidadkhparvvraigelarcigseglvagqvvdlemtvplerleyih
    lhktaalleasvvigailgggsdeqieslrmyarsigllfqvvddildvtkttypkllgl
    eksrefaekllsdareqlsgfdqetaapllhlanyiayrqn