PDB entry 5xmo

View 5xmo on RCSB PDB site
Description: X-ray crystal structure of Pseudoazurin Met16Phe/Thr36Lys variant
Class: electron transport
Keywords: Electron transfer, Cupredoxin, ELECTRON TRANSPORT
Deposited on 2017-05-16, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pseudoazurin
    Species: Achromobacter cycloclastes [TaxId:223]
    Gene: BCP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19567 (0-123)
      • engineered mutation (15)
      • engineered mutation (35)
    Domains in SCOPe 2.07: d5xmoa_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmoA (A:)
    adfevhmlnkgkdgafvfepaslkvapgdtvtfipkdkghnvetikgmipdgaeafkski
    nenykvtftapgvygvkctphygmgmvgvvqvgdapanleavkgaknpkkaqerldaala
    algn