PDB entry 5xmm

View 5xmm on RCSB PDB site
Description: fla-e*01801-167w/s
Class: immune system
Keywords: Domestic cats, MHC I, Feline immunodeficiency virus, CTL immunity, IMMUNE SYSTEM
Deposited on 2017-05-15, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen alpha chain
    Species: Felis catus [TaxId:9685]
    Gene: FLA-I
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6ZK72 (0-274)
      • engineered mutation (166)
    Domains in SCOPe 2.06: d5xmma1, d5xmma2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Felis catus [TaxId:9685]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5MGS7 (1-98)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5xmmb_
  • Chain 'C':
    Compound: gag polyprotein
    Species: Feline immunodeficiency virus [TaxId:11674]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16087 (0-8)
      • engineered mutation (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5xmmA (A:)
gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcveslakyldmgketll
raespntrvtrhpisdrevtlrcwalgfypaeitltwqrdgqdhtqdaelvetrpagdgt
fqkwaavvvssgeeqrytchvqheglrepitlrwe

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5xmmB (B:)
mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw
tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm

  • Chain 'C':
    No sequence available.