PDB entry 5xmf

View 5xmf on RCSB PDB site
Description: Crystal structure of feline MHC class I for 2,1 angstrom
Class: immune system
Keywords: domestic cats, MHC I, Feline immunodeficiency virus, CTL immunity, IMMUNE SYSTEM
Deposited on 2017-05-15, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class I antigen alpha chain
    Species: Felis catus [TaxId:9685]
    Gene: FLA-I
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5xmfa1, d5xmfa2
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Felis catus [TaxId:9685]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5MGS7 (1-98)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5xmfb_
  • Chain 'C':
    Compound: gag polyprotein
    Species: Feline immunodeficiency virus [TaxId:11674]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmfA (A:)
    gshslryfytavsrpglgeprfiavgyvddtqfvrfdsdapnprmeprapwveqegpeyw
    dretrkvkntaqifrvdlntllryynqsesgshniqrmygcdvepdgrllrgynqdsydg
    kdyialnedlrswtaadtaaqitgrkweeageaerwrnylqgtcvewlakyldmgketll
    raespntrvtrhpisdrevtlrcwalgfypaeitltwqrdgqdhtqdaelvetrpagdgt
    fqkwaavvvssgeeqrytchvqheglrepitlrwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xmfB (B:)
    mvqhspkvqvysrhpaengkpnflncyvsgfhppqiditlmkngkkmeaeqtdlsfnrdw
    tfyllvhteftptvedeyscqvnhttlsepkvvkwdrdm
    

  • Chain 'C':
    No sequence available.