PDB entry 5xkd

View 5xkd on RCSB PDB site
Description: Crystal structure of dibenzothiophene sulfone monooxygenase BdsA in complex with FMN at 2.4 angstrom
Class: oxidoreductase
Keywords: dibenzothiophene desulfurization enzyme, monooxygenase, flavin mononucleotide, OXIDOREDUCTASE
Deposited on 2017-05-07, released 2018-05-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-09, with a file datestamp of 2018-05-04.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xkda_
  • Chain 'B':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xkdb_
  • Chain 'C':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xkdc_
  • Chain 'D':
    Compound: Dibenzothiophene desulfurization enzyme A
    Species: Bacillus subtilis [TaxId:1423]
    Gene: bdsA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xkdd_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xkdA (A:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xkdA (A:)
    rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie
    dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl
    dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll
    dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea
    vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv
    hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael
    grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq
    qrgvfrteyegttlrehlglahpev
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xkdB (B:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xkdB (B:)
    rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie
    dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl
    dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll
    dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea
    vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv
    hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael
    grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq
    qrgvfrteyegttlrehlglahpev
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xkdC (C:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xkdC (C:)
    rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie
    dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl
    dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll
    dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea
    vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv
    hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael
    grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq
    qrgvfrteyegttlrehlglahpev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xkdD (D:)
    maeqrqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdg
    laiedsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarv
    fatldnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsed
    allldkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagr
    waeavfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleyl
    nslvhpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadlt
    laelgrrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvv
    pllqqrgvfrteyegttlrehlglahpevgsir
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xkdD (D:)
    rqlhlagffsagnvthahgawrhvgatngfltgefykqiartlergkfdllflpdglaie
    dsygdnletgvglggqgavaleptsviatmaavtqrlglgatvsttyyppyhvarvfatl
    dnlsdgriswnvvtslndsearnfgvdehlehdirydradefleavkklwsswsedalll
    dkvggrfadpkkvqyvnhrgrwlsvrgplqvprsrqgepvilqaglsprgrrfagrwaea
    vfsvspnldimravyqdikahvaaagrdpeqtkvftavmpvlgeteqvarerleylnslv
    hpevglstlsshsglnlskypldtkfsdivadlgdrhvptmlqmfsavagggadltlael
    grrygtnvgfvpqwagtaeqiadqlishfeagaadgfiispaylpgiyeefvdqvvpllq
    qrgvfrteyegttlrehlglahpev