PDB entry 5xjr

View 5xjr on RCSB PDB site
Description: Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with SmD1(1-82)/D2/F/E/G from Human
Class: splicing
Keywords: splicing
Deposited on 2017-05-04, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '2':
    Compound: Gem-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN2, SIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjra_
  • Chain 'B':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2, SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjrb_
  • Chain 'E':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjre_
  • Chain 'F':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjrf_
  • Chain 'G':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjrg_
  • Chain 'M':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SMN1, SMN, SMNT, SMN2, SMNC
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain '2':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xjrA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjrA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xjrB (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjrB (B:)
    elqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemw
    tevkpvnkdryiskmflrgdsvivvlrnpliag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xjrE (E:)
    mayrgqgqkvqkvmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvldd
    aeeihsktksrkqlgrimlkgdnitllqsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjrE (E:)
    mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq
    lgrimlkgdnitllqsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xjrF (F:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjrF (F:)
    lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
    lircnnvlyirgve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xjrG (G:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjrG (G:)
    kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvemagqqnnigmvvirgnsiimle
    a
    

  • Chain 'M':
    No sequence available.