PDB entry 5xjl

View 5xjl on RCSB PDB site
Description: Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with SmD1/D2/F/E/G from Human
Class: splicing
Keywords: splicing
Deposited on 2017-05-02, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '2':
    Compound: Gem-associated protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN2, SIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: Small nuclear ribonucleoprotein Sm D1
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjla_
  • Chain 'B':
    Compound: Small nuclear ribonucleoprotein Sm D2
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPD2, SNRPD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjlb_
  • Chain 'E':
    Compound: Small nuclear ribonucleoprotein E
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjle_
  • Chain 'F':
    Compound: Small nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPF, PBSCF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjlf_
  • Chain 'G':
    Compound: Small nuclear ribonucleoprotein G
    Species: Homo sapiens [TaxId:9606]
    Gene: SNRPG, PBSCG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xjlg_
  • Chain 'M':
    Compound: Survival motor neuron protein
    Species: Homo sapiens [TaxId:9606]
    Gene: SMN1, SMN, SMNT, SMN2, SMNC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain '2':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xjlA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllvdvepkvkskkreavagrgrgrgrgrgrgrgrgrggprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjlA (A:)
    mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
    rgnniryfilpdslpldtllv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xjlB (B:)
    msllnkpksemtpeelqkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafd
    rhcnmvlenvkemwtevpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjlB (B:)
    eefntgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpvnk
    dryiskmflrgdsvivvlrnpliag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5xjlE (E:)
    mayrgqgqkvqkvmvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvldd
    aeeihsktksrkqlgrimlkgdnitllqsvsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjlE (E:)
    mvqpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkq
    lgrimlkgdnitllqsv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5xjlF (F:)
    mslplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlg
    evlircnnvlyirgveeeeedgemre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjlF (F:)
    lplnpkpflngltgkpvmvklkwgmeykgylvsvdgymnmqlanteeyidgalsghlgev
    lircnnvlyirgve
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5xjlG (G:)
    mskahppelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmv
    virgnsiimlealerv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xjlG (G:)
    elkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgnnigmvvirgnsiim
    lea
    

  • Chain 'M':
    No sequence available.