PDB entry 5xj4

View 5xj4 on RCSB PDB site
Description: Complex structure of durvalumab-scFv/PD-L1
Class: immune system
Keywords: durvalumab, PD-L1, complex structure, IMMUNE SYSTEM
Deposited on 2017-04-29, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death 1 ligand 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD274, B7H1, PDCD1L1, PDCD1LG1, PDL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZQ7 (1-End)
      • expression tag (0)
  • Chain 'H':
    Compound: durvalumab-VH
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5XJ4 (0-End)
    Domains in SCOPe 2.07: d5xj4h_
  • Chain 'L':
    Compound: durvalumab-VL
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5XJ4 (0-End)
    Domains in SCOPe 2.07: d5xj4l_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5xj4H (H:)
    evqlvesggglvqpggslrlscaasgftfsrywmswvrqapgkglewvanikqdgsekyy
    vdsvkgrftisrdnaknslylqmnslraedtavyycareggwfgelafdywgqgtlvtvs
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xj4H (H:)
    evqlvesggglvqpggslrlscaasgftfsrywmswvrqapgkglewvanikqdgsekyy
    vdsvkgrftisrdnaknslylqmnslraedtavyycareggwfgelafdywgqgtlvtvs
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5xj4L (L:)
    eivltqspgtlslspgeratlscrasqrvsssylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygslpwtfgqgtkveikrggggs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xj4L (L:)
    eivltqspgtlslspgeratlscrasqrvsssylawyqqkpgqaprlliydassratgip
    drfsgsgsgtdftltisrlepedfavyycqqygslpwtfgqgtkveikrgggg