PDB entry 5xhr

View 5xhr on RCSB PDB site
Description: Crystal structure of P99 beta-lactamase in complex with a penicillin derivative MPC-1
Class: hydrolase
Keywords: hydrolase
Deposited on 2017-04-24, released 2017-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xhra_
  • Heterogens: PXH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xhrA (A:)
    gpgstpvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtp
    qtlfelgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagg
    lplqvpdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamtt
    rvlkplkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvma
    nmapenvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalapl
    pvaevnppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhi
    lealq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xhrA (A:)
    pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
    lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
    pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
    lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
    nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
    nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal