PDB entry 5xh3

View 5xh3 on RCSB PDB site
Description: Crystal structure of a novel PET hydrolase R103G/S131A mutant in complex with HEMT from Ideonella sakaiensis 201-F6
Class: hydrolase
Keywords: Poly(ethylene terephthalate) hydrolase, substrate binding, inhibitor, HYDROLASE
Deposited on 2017-04-19, released 2017-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (0-260)
      • engineered mutation (102)
      • engineered mutation (130)
    Domains in SCOPe 2.06: d5xh3a_
  • Heterogens: 856, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5xh3A (A:)
    npyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyta
    rqssikwwgprlashgfvvitidtnstldqpssrssqqmaalgqvaslngtssspiygkv
    dtarmgvmgwamggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsia
    pvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtrys
    tfacenpnstrvsdfrtancs