PDB entry 5xgk

View 5xgk on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase (AtHPPD) complexed with its substrate 4-hydroxyphenylpyruvate acid (HPPA)
Class: oxidoreductase
Keywords: 4-Hydroxyphenylpyruvate Dioxygenase, catalytic mechanism, drug discovery, OXIDOREDUCTASE
Deposited on 2017-04-14, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xgka1, d5xgka2
  • Chain 'B':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xgkb1, d5xgkb2
  • Chain 'C':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xgkc1, d5xgkc2
  • Chain 'D':
    Compound: 4-hydroxyphenylpyruvate dioxygenase
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: HPD, PDS1, At1g06570, F12K11.9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5xgkd1, d5xgkd2
  • Heterogens: TYF, FE, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xgkA (A:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgkA (A:)
    fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
    lltsgdlrflftapyspsptttasipsfdhgscrsffsshglgvravaievedaesafsi
    svangaipssppivlneavtiaevklygdvvlryvsflpgfervedpldygirrldhavg
    nvpelgpaltyvagftgfhqfaeftsglnsavlasndemvllpinepvksqiqtylehne
    gaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikec
    eelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfselfk
    sieeyekt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5xgkB (B:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgkB (B:)
    skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
    ltsgdlrflftapyspslsttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsykflpgfervedfpldygirrldha
    vgnvpelgpaltyvagftgfhqfaefsglnsavlasndemvllpinepkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfsel
    fksieey
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5xgkC (C:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgkC (C:)
    skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
    ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsyflpgfervedasspldygirrldh
    avgnvpelgpaltyvagftgfhqfaeftalnsavlasndemvllpinepvtkrksqiqty
    lehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsdd
    qikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmqsggcggfgkgnfs
    elfksieeyektle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5xgkD (D:)
    mghqnaavsenqnhddgaasspgfklvgfskfvrknpksdkfkvkrfhhiefwcgdatnv
    arrfswglgmrfsaksdlstgnmvhasylltsgdlrflftapyspslsageikptttasi
    psfdhgscrsffsshglgvravaievedaesafsisvangaipssppivlneavtiaevk
    lygdvvlryvsykaedtekseflpgfervedassfpldygirrldhavgnvpelgpalty
    vagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrksqiqtyleh
    negaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqik
    eceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayqsggcggfg
    kgnfselfksieeyektleakqlvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xgkD (D:)
    skfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasyl
    ltsgdlrflftapyspsltttasipsfdhgscrsffsshglgvravaievedaesafsis
    vangaipssppivlneavtiaevklygdvvlryvsykaeflpgfervedpldygirrldh
    avgnvpelgpaltyvagftgfhqfaeftalnsavlasndemvllpinepvkrksqiqtyl
    ehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddq
    ikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmqsggcggfgkgnfsel
    fksieeyek