PDB entry 5xff

View 5xff on RCSB PDB site
Description: Crystal structure of LY2874455 in complex of FGFR4 gatekeeper mutation (V550L)
Class: transferase
Keywords: inhibitor, kinase, gatekeeper, mutation, TRANSFERASE
Deposited on 2017-04-10, released 2018-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-05, with a file datestamp of 2018-08-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 4
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR4, JTK2, TKF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22455
      • conflict (34)
      • engineered mutation (107)
    Domains in SCOPe 2.07: d5xffa_
  • Heterogens: 6LF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5xffA (A:)
    gpllaglvsldlpldplwefprdrlvlgkplgegafgqvvraeafgmdparpdqastvav
    kmlkdnasdkdladlvsemevmkligrhkniinllgvctqegplyvilecaakgnlrefl
    rarrppgpdlspdgprssegplsfpvlvscayqvargmqylesrkcihrdlaarnvlvte
    dnvmkiadfglargvhhidyykktsngrlpvkwmapealfdrvythqsdvwsfgillwei
    ftlggspypgipveelfsllreghrmdrpphcppelyglmrecwhaapsqrptfkqlvea
    ldkvllavsee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5xffA (A:)
    dlpldplwefprdrlvlgkplgegafgqvvraeafgmdparpdqastvavkmlkdnasdk
    dladlvsemevmkligrhkniinllgvctqegplyvilecaakgnlreflrarrppgppl
    sfpvlvscayqvargmqylesrkcihrdlaarnvlvtednvmkiadfgllpvkwmapeal
    fdrvythqsdvwsfgillweiftlggspypgipveelfsllreghrmdrpphcppelygl
    mrecwhaapsqrptfkqlvealdkvllav