PDB entry 5x9l

View 5x9l on RCSB PDB site
Description: Recombinant thaumatin I at 0.9 Angstrom
Class: plant protein
Keywords: Sweet-tasting protein, Sweet receptor, PLANT PROTEIN
Deposited on 2017-03-08, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 0.9 Å
R-factor: N/A
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thaumatin I
    Species: Thaumatococcus daniellii [TaxId:4621]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5x9la_
  • Heterogens: TLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5x9lA (A:)
atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmdfspttrg
crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
fsyvldkpttvtcpgssnyrvtfcpta