PDB entry 5x99

View 5x99 on RCSB PDB site
Description: T18V mutant of thermus thermophilus HB8 thymidylate kinase
Class: transferase
Keywords: Nucleotide monophosphate kinase, TRANSFERASE
Deposited on 2017-03-06, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHX3
      • engineered mutation (17)
    Domains in SCOPe 2.07: d5x99a_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: tmk, TTHA1607
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHX3
      • engineered mutation (17)
    Domains in SCOPe 2.07: d5x99b_
  • Heterogens: FMT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x99A (A:)
    mpglfltlegldgsgktvqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x99A (A:)
    pglfltlegldgsgktvqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaalrgleffrrvregylalaraepgrfvvldatlpeeeiaraiqah
    lrpll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x99B (B:)
    mpglfltlegldgsgktvqarrlaafleaqgrpvlltrepggglpevrsllltqelspea
    eyllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatr
    glkprltflldlppeaalrrvrrpdrleglgleffrrvregylalaraepgrfvvldatl
    peeeiaraiqahlrpllp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x99B (B:)
    pglfltlegldgsgktvqarrlaafleaqgrpvlltrepggglpevrsllltqelspeae
    yllfsadraehvrkvilpglaagkvvisdryldsslayqgygrglplpwlrevareatrg
    lkprltflldlppeaagleffrrvregylalaraepgrfvvldatlpeeeiaraiqahlr
    pll