PDB entry 5x8u

View 5x8u on RCSB PDB site
Description: Crystal Structure of the wild Human ROR gamma Ligand Binding Domain.
Class: transferase/inhibitor
Keywords: Inhibitor, Binary Complex, Nuclear Receptor, TRANSFERASE-INHIBITOR complex
Deposited on 2017-03-03, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Nomascus leucogenys [TaxId:61853]
    Gene: RORC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x8ua_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, BHLHE74, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x8uA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8uA (A:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfs
    

  • Chain 'B':
    No sequence available.