PDB entry 5x8s

View 5x8s on RCSB PDB site
Description: Crystal Structure of the mutant Human ROR gamma Ligand Binding Domain With Ursolic acid.
Class: transferase/inhibitor
Keywords: Inhibitor, Binary Complex, Nuclear Receptor, TRANSFERASE-INHIBITOR complex
Deposited on 2017-03-03, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Nomascus leucogenys [TaxId:61853]
    Gene: RORC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x8sa_
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Nomascus leucogenys [TaxId:61853]
    Gene: RORC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5x8sb_
  • Heterogens: 6Q5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5x8sA (A:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8sA (A:)
    pyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5x8sB (B:)
    eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5x8sB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqa